Tesamorelin Canada: GHRH(1-44) Analogue Research Guide

Tesamorelin: Structure, Trial Evidence and Regulatory Status in Canada

By the ThePeptide.ca Research Team · Written from primary literature and regulatory records · Research use only · Last updated 13 September 2026

Quick answer

Tesamorelin is a synthetic analogue of human growth hormone-releasing factor, GRF(1–44)NH₂, carrying a trans-3-hexenoyl group on the N-terminal tyrosine that makes it resistant to dipeptidyl aminopeptidase-IV cleavage. That single modification is the compound’s whole reason for existing: it slows degradation of an otherwise short-lived 44-residue peptide enough to make the molecule clinically testable at all, which is why Tesamorelin — almost uniquely in this compound class — completed two multicentre randomised phase 3 trials in 806 pooled patients and holds regulatory authorisations in both the United States (2010) and Canada (2014).

Note on availability. ThePeptide.ca stocks Tesamorelin 10mg at $99.99 CAD. The current lot, CS-te10-0616, was independently assayed by Janoshik Analytical — the manufacturer’s third-party laboratory — at 99.174% by HPLC with 11.56 mg of measured peptide content, published under Janoshik ref #198440 and readable on that laboratory’s own system. That lot is now with Testides in Toronto for our own confirmatory HPLC, so it is listed as pending on our lab results page until that certificate is released. It is supplied strictly as a laboratory research material, is not approved by Health Canada or the FDA, and is not for human or veterinary use. This page remains a compound reference: Tesamorelin is the best-documented compound in the GHRH-analogue class and is therefore the correct reference point for reading the rest of that class.
Research use only This article summarises published laboratory research, clinical trial literature and regulatory records for research reference. It is not medical advice. It contains no dosing, administration, injection, reconstitution, dilution or preparation guidance of any kind, and dose levels used in the cited trials are deliberately not reproduced here — they are stated in the primary sources for readers who need them. Tesamorelin is not approved by Health Canada or the FDA for any use outside its authorised prescription indication, and nothing here is a therapeutic claim.

Key takeaways

  • It is a 44-residue GHRH analogue, not a pentapeptide secretagogue. Tesamorelin acts at the GRF (GHRH) receptor, not at GHS-R, which places it opposite Ipamorelin on the growth-hormone axis.
  • The trans-3-hexenoyl group is the innovation. Ferdinandi et al. (2007) showed the modified peptide resists dipeptidyl aminopeptidase-IV deactivation and degrades more slowly in rat, dog and human plasma than native hGRF(1–44)NH₂.
  • It has real randomised human data. 412 patients in NEJM (2007), 404 in JAIDS (2010), 806 pooled in JCEM (2010) — a depth of evidence no other peptide in this class approaches.
  • Effect sizes are specific and reproducible. Visceral adipose tissue fell 15.2% versus a 5.0% rise on placebo at 26 weeks in the pivotal trial; the pooled placebo-adjusted treatment effect was −15.4%.
  • Regulators split on it. FDA approved it on 10 November 2010; Health Canada issued a Notice of Compliance on 29 April 2014; the European application was withdrawn on 26 June 2012 after the CHMP could not conclude a positive benefit–risk balance.
  • It is no longer marketed in Canada. Health Canada’s Summary Basis of Decision lists both Canadian DINs as discontinued.

What is Tesamorelin?

Tesamorelin is a synthetic 44-amino-acid analogue of human growth hormone-releasing factor — hGRF(1–44)NH₂, also called GHRH or somatoliberin — modified by the addition of a trans-3-hexenoyl moiety to the tyrosine at position 1. It was developed by Theratechnologies Inc. under the code TH9507 and is marketed as Egrifta. Its parent sequence is the mature somatoliberin chain, residues 32–75 of UniProt P01286, C-terminally amidated at leucine. At 5,135.9 Da it is roughly seven times the mass of the pentapeptide Ipamorelin (711.85 Da) and more than twice that of the 16-mer MOTS-c (2,174.62 Da), which changes how it behaves in every analytical and stability context discussed below.

Sequence (parent GRF 1–44):
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL–NH₂
Tesamorelin = trans-3-hexenoyl–Tyr¹ of the above.

Class Growth hormone-releasing factor (GRF/GHRH) analogue
Development code TH9507 (Theratechnologies Inc.)
Length 44 residues, C-terminally amidated
N-terminal modification trans-3-hexenoyl (C6 chain, double bond at position 3) on Tyr¹
Molecular formula C₂₂₁H₃₆₆N₇₂O₆₇S (acetate salt: · x C₂H₄O₂, x ≈ 7)
Molecular weight 5,135.9 Da (free-base equivalent)
CAS number 218949-48-5 (free base); 901758-09-6 (acetate)
Receptor Human GRF (GHRH) receptor on anterior pituitary somatotrophs — not GHS-R
Physical form White to off-white preservative-free lyophilised powder
Regulatory status FDA approved 2010; Health Canada NOC 29 April 2014; EU application withdrawn 2012
Availability here In stock — Tesamorelin 10mg, $99.99 CAD, lot CS-te10-0616, 99.174% on a Janoshik assay (ref #198440); Testides confirmation pending
↑ Back to top

What does the trans-3-hexenoyl group actually do?

It blocks enzymatic destruction of the peptide’s N-terminus. Native hGRF is cleaved between Tyr¹ and Ala² by dipeptidyl aminopeptidase-IV (DPP-4), which removes the first two residues and abolishes receptor activity almost immediately. Ferdinandi and colleagues reported in Basic & Clinical Pharmacology & Toxicology (2007) that TH9507, described as “minimally modified by addition of a trans-3-hexenoyl moiety to Tyr1 of the amino acid sequence,” was “found to be resistant to dipeptidyl aminopeptidase-IV deactivation.” The same paper showed the modification slowed in-vitro degradation in rat, dog and human plasma and prolonged in-vivo elimination kinetics relative to unmodified hGRF(1–44)NH₂.

“In conclusion, TH9507 is a modified hGRF peptide having enhanced potency and duration of action.” — Ferdinandi et al., Basic & Clinical Pharmacology & Toxicology, 2007 (PMID 17214611)

This is the cleanest worked example in the peptide literature of a single acylation solving a single protease problem, and it is why Tesamorelin is often used as the teaching case when explaining N-terminal stabilisation to people new to the field. Our beginner’s guide to peptides covers why peptide backbones are so vulnerable to peptidases in the first place.

↑ Back to top

How does Tesamorelin work at the receptor?

Tesamorelin binds and activates the human GRF receptor on anterior pituitary somatotroph cells, and the FDA-approved labelling states it does so “with similar potency as the endogenous GRF.” Receptor activation stimulates the synthesis and pulsatile release of endogenous growth hormone, which in turn drives hepatic production of insulin-like growth factor-1 (IGF-1). Because the signal enters the axis upstream of the pituitary rather than replacing growth hormone directly, the resulting secretion retains its pulsatile character and remains subject to negative feedback from IGF-1 and somatostatin. In the pivotal trial, IGF-1 rose 81.0% in the Tesamorelin arm while falling 5.0% on placebo — the pharmacodynamic marker that confirms target engagement.

Why the receptor identity matters: GHRH-receptor agonists such as Tesamorelin, CJC-1295 and sermorelin amplify a physiological pulse the pituitary is already generating. GHS-R agonists such as Ipamorelin, GHRP-2 and GHRP-6 act on the separate ghrelin receptor and can initiate release. Anything that describes Tesamorelin as a “ghrelin mimetic” has the pharmacology wrong.
↑ Back to top

What are Tesamorelin’s pharmacokinetics?

Tesamorelin is cleared extremely fast: the prescribing information for Egrifta SV reports a mean elimination half-life of 8 minutes in healthy subjects, and the Egrifta WR labelling reports 11 minutes. Absolute subcutaneous bioavailability is under 4%, median time to peak concentration is 0.15 hours in both healthy subjects and HIV-infected patients, and mean volume of distribution is 4.8 ± 1.9 L/kg. Systemic exposure (AUC) is approximately 34% higher in HIV-infected patients than in healthy subjects while peak concentration is similar. In the dog toxicokinetic work, apparent elimination half-life for immunoreactive TH9507 ranged from 21 to 45 minutes.

Short half-life is not a design flaw here. The molecule’s job is to trigger a pulse, not to maintain a plasma level. A rapidly cleared GHRH signal produces a discrete secretory episode; the downstream IGF-1 response is what persists and what is measured.
↑ Back to top

How does Tesamorelin differ from Ipamorelin and CJC-1295?

All three touch the growth hormone axis, but Tesamorelin and CJC-1295 are GHRH-receptor analogues while Ipamorelin is a ghrelin-receptor secretagogue — and only Tesamorelin has completed multicentre randomised phase 3 trials. The table below sets the three side by side on the properties that actually distinguish them. Our CJC-1295 + Ipamorelin guide covers the two-receptor rationale in more depth.

Tesamorelin CJC-1295 Ipamorelin
Class GRF/GHRH analogue GHRH analogue GHS-R agonist
Receptor GRF (GHRH) receptor GHRH receptor GHS-R (ghrelin receptor)
Length 44 residues 29-residue analogue 5 residues
Stabilising strategy trans-3-hexenoyl on Tyr¹ Residue substitutions; DAC variant adds albumin binding D-amino acids and Aib
Direction of effect on GH Amplifies existing pulses Amplifies existing pulses Can initiate release
Randomised phase 3 human data Yes — two multicentre trials, 806 pooled patients No No — one phase 2 trial, primary endpoint not met
Regulatory approval FDA 2010; Health Canada 2014 None None
↑ Back to top

What did the phase 3 human trials actually find?

Two multicentre, double-blind, placebo-controlled 26-week trials with 52-week safety extensions both met their primary endpoint of reducing visceral adipose tissue, and the pooled placebo-adjusted treatment effect was −15.4%. The first (Falutz et al., New England Journal of Medicine, 2007) randomised 412 antiretroviral-treated patients with abdominal fat accumulation; visceral adipose tissue fell 15.2% on Tesamorelin and rose 5.0% on placebo, triglycerides fell 50 mg/dL versus a 9 mg/dL rise, and no significant between-group glycaemic differences emerged. The confirmatory trial (Falutz et al., JAIDS, 2010) randomised 404 patients; the trials and their extensions are registered as NCT00435136 and NCT00608023.

Trial n randomised Duration VAT result at 26 weeks
Falutz 2007, NEJM (LIPO-010) 412 26 weeks −15.2% vs +5.0% placebo
Falutz 2010, JAIDS (CTR-1011) 404 26 weeks + 26-week extension −10.9% (−21 cm²) vs −0.6% (−1 cm²)
Falutz 2010, JCEM (pooled) 806 26 weeks + extension to 52 Treatment effect −15.4%

Two findings from the extension phase are worth isolating. Continued treatment to week 52 produced roughly 18% visceral fat reduction, and reductions were maintained against original baseline. But in patients switched off the compound, the effect reversed rapidly — the change was not durable once the GHRH signal stopped. CADTH’s independent review recorded least-squares mean differences of −19.6% (95% CI −23.7 to −15.3) in LIPO-010 and −11.7% (95% CI −16.2 to −7.1) in CTR-1011, illustrating a real between-trial spread that pooled figures conceal.

↑ Back to top

What did the liver-fat trials show?

Two investigator-initiated randomised trials at Massachusetts General Hospital extended the work from visceral fat to hepatic fat, and both reported reductions. Stanley et al. (JAMA, 2014) randomised 50 antiretroviral-treated participants with abdominal fat accumulation — 28 to Tesamorelin, 22 to placebo — over six months: visceral adipose tissue changed by a mean of −34 cm² versus +8 cm² on placebo (P = .005) and liver fat by a median of −2.0% versus +0.9% (P = .003). Stanley et al. (Lancet HIV, 2019; NCT02196831) then ran a 12-month trial in 61 enrolled participants with a hepatic fat fraction of 5% or more, randomised 30 and 30.

Endpoint (Lancet HIV 2019) Result
Absolute change in hepatic fat fraction −4.1% (95% CI −7.6 to −0.7), p = 0.018
Relative change from baseline −37% (95% CI −67 to −7), p = 0.016
Reaching hepatic fat fraction < 5% 35% vs 4% on placebo, p = 0.0069
Fasting glucose and HbA1c at 12 months No difference between groups

The authors’ own conclusion was deliberately conditional: Tesamorelin “might be beneficial in people with HIV and NAFLD,” with further studies needed on long-term histology. That hedge is the correct reading, and it is more informative than the confident summaries that circulate elsewhere.

↑ Back to top

Has Tesamorelin been studied outside HIV?

Yes — in cognitive ageing and in type 2 diabetes, in two randomised placebo-controlled trials that are frequently overlooked. Baker et al. (Archives of Neurology, 2012) ran a 20-week trial in 152 adults with a mean age of 68, of whom 66 had mild cognitive impairment. The trial reported favourable effects on overall cognition (intention-to-treat P = .03; completer analysis P = .002), a significant effect on executive function (P = .005), a non-significant trend in verbal memory (P = .08), an IGF-1 increase of 117%, and a 7.4% reduction in body fat. Fasting insulin rose 35% in the mild-cognitive-impairment group, which the authors flagged rather than buried.

Clemmons et al. (PLOS ONE, 2017; NCT01264497) took the opposite question — whether a GHRH analogue would worsen glycaemic control — in a 12-week trial in 53 patients with type 2 diabetes. No significant between-group differences appeared in relative insulin response, fasting glucose, HbA1c or overall diabetes control, and no patient discontinued for loss of diabetes control. Friedman et al. (JAMA Neurology, 2013) separately examined brain GABA levels in the cognitive-ageing cohort by magnetic resonance spectroscopy.

↑ Back to top

Is Tesamorelin approved in Canada?

It was authorised and then withdrawn from the market. Health Canada issued a Notice of Compliance for Egrifta (tesamorelin acetate) to Theratechnologies Inc. on 29 April 2014 under submission control NDS #131836, for the treatment of excess visceral adipose tissue in treatment-experienced adult HIV-infected patients with lipodystrophy. Health Canada’s Summary Basis of Decision records DIN 02423677 (2 mg/vial) as discontinued pre-market and DIN 02438712 (1 mg/vial) as discontinued post-market. The practical position in 2026 is therefore that Tesamorelin has a Canadian regulatory history but no marketed Canadian product, and no Health Canada authorisation for any purpose beyond that lapsed prescription indication.

Jurisdiction Outcome Date
United States (FDA) Approved as Egrifta; later formulations Egrifta SV and Egrifta WR 10 November 2010
European Union (EMA) Marketing authorisation application withdrawn by the applicant; CHMP “considers that the provided data do not allow it to conclude on a positive benefit-risk balance” 26 June 2012
Canada (Health Canada) Notice of Compliance issued; both DINs subsequently discontinued 29 April 2014

The wider Canadian framework matters more than the individual file. On 9 April 2026 Health Canada published a public advisory, “Think twice before injecting peptides bought online: unauthorized products can seriously harm you,” stating that peptides of this kind are generally regulated as prescription drugs, that unauthorized drug products are illegal, and that this type of labelling does not make these products legal or exempt from regulatory requirements. On 11 June 2026 the Superior Court of Québec granted Health Canada a permanent injunction against a Canadian seller of injectable peptides; Health Canada announced it publicly on 29 July 2026. Enforcement is active. Read the advisory itself, and our fuller account in Are peptides legal in Canada?

↑ Back to top

Where does Tesamorelin sit on the evidence scale?

At the top of the peptide research field, and it is not close. Most compounds discussed in this category rest on cell-culture work, rodent models and a handful of small open-label human series. Tesamorelin has two independent multicentre randomised double-blind placebo-controlled phase 3 trials with pre-specified primary endpoints, a pooled analysis of 806 patients, 52-week extension data, two further randomised trials in liver fat, a randomised cognition trial in 152 adults, a randomised safety trial in 53 patients with type 2 diabetes, and full regulatory review dossiers in three jurisdictions. Our evidence-tier ranking places compounds on exactly this scale.

The honest caveat: that evidence is dense but narrow. Nearly all of it is in one population — antiretroviral-treated adults with HIV-associated visceral fat accumulation — studied for one endpoint under investigator supervision. Strong evidence for a specific question in a specific group is not general evidence, and it is not transferable to any other context.
↑ Back to top

Is Tesamorelin banned in sport?

Yes. Tesamorelin is named explicitly on the World Anti-Doping Agency Prohibited List under section S2, Peptide Hormones, Growth Factors, Related Substances and Mimetics. The relevant entry covers “growth hormone-releasing hormone (GHRH) and its analogues (e.g. CJC-1293, CJC-1295, sermorelin and tesamorelin).” Section S2 substances are prohibited at all times, in and out of competition, so the existence of a therapeutic authorisation in one country does not change the anti-doping position. The listing is class-wide rather than compound-specific: the GHRH analogues and the GHS-R agonists that appear elsewhere in section S2 are covered by the same section, which is why the whole growth-hormone-axis category is treated as one under the WADA code.

↑ Back to top

How is a 44-residue peptide like Tesamorelin verified in the laboratory?

Purity by reversed-phase HPLC with UV detection, identity by mass spectrometry against a 5,135.9 Da free-base target — but a 44-mer is a materially harder analytical problem than a 5-mer. Longer sequences accumulate more deletion and truncation impurities during solid-phase synthesis, and a single missing residue in a 44-residue chain shifts mass by a fraction of a percent, so low-resolution mass checks can miss it. Electrospray ionisation produces a multiply charged envelope that must be deconvoluted before the measured mass means anything, and the acetate counter-ion content means the vial mass and the peptide mass are not the same number. Our guide to independent peptide testing in Canada covers what a defensible certificate of analysis contains, and our published lot certificates show the format we use.

↑ Back to top

Why is Tesamorelin harder to keep stable than a short peptide?

Length and composition both work against it: a 44-residue chain simply presents more chemically labile sites than a five-residue one. The sequence carries a single methionine at position 27, the residue most readily oxidised in any peptide; two asparagines, at positions 8 and 35, with the Asn8–Ser9 pair in particular sitting at a motif of the type associated with deamidation; and five glutamines. None of that is speculative chemistry — it is read directly off the published sequence. The approved labelling describes the material as a white to off-white, preservative-free lyophilised powder, which is itself a stability statement: nothing in the vial protects it from moisture, oxygen or heat. General physicochemical principles for lyophilised research peptides are set out in our storage and stability guide. This page gives no preparation or handling instructions.

↑ Back to top

Does ThePeptide.ca stock Tesamorelin?

Yes. Tesamorelin 10mg is in stock at $99.99 CAD, supplied strictly as a laboratory research material. The current lot is CS-te10-0616, independently assayed by Janoshik Analytical — the manufacturer’s third-party laboratory — at 99.174% purity by HPLC with 11.56 mg of measured peptide content per vial, published under Janoshik ref #198440 and readable on that laboratory’s own system at verify.janoshik.com. That is a manufacturer result rather than a certificate issued to us: the lot is with Testides in Toronto for our own confirmatory HPLC, and it is shown as pending on our lab results page until that certificate is released. Within the growth-hormone-axis category it sits alongside the GHS-R agonist Ipamorelin 10mg and the combined CJC-1295 + Ipamorelin 10mg preparation. None of these is approved by Health Canada or the FDA, and none is sold for human or veterinary use. If you are reading this page to compare compounds, the honest comparison is that Tesamorelin has the trial record and the others do not.

↑ Back to top

Frequently asked questions

What is Tesamorelin?

Tesamorelin is a synthetic 44-amino-acid analogue of human growth hormone-releasing factor, hGRF(1-44)NH2, modified by the addition of a trans-3-hexenoyl group to the tyrosine at position 1. It was developed under the code TH9507 by Theratechnologies Inc. and is marketed as Egrifta. Its molecular weight is 5,135.9 Da as the free base, its molecular formula is C221H366N72O67S, and its CAS number is 218949-48-5.

What does the trans-3-hexenoyl group do?

It protects the peptide from dipeptidyl aminopeptidase-IV, the enzyme that cleaves native growth hormone-releasing factor between residues 1 and 2 and inactivates it. Ferdinandi and colleagues reported in 2007 that TH9507 was resistant to dipeptidyl aminopeptidase-IV deactivation, that the modification slowed in-vitro degradation in rat, dog and human plasma, and that it prolonged in-vivo elimination kinetics compared with unmodified hGRF(1-44)NH2.

How is Tesamorelin different from Ipamorelin?

They act on different receptors and are different sizes. Tesamorelin is a 44-residue growth hormone-releasing factor analogue acting at the GRF receptor on pituitary somatotrophs, amplifying a physiological growth hormone pulse. Ipamorelin is a five-residue agonist at the growth hormone secretagogue receptor, the receptor ghrelin binds, and can initiate release. Tesamorelin is roughly seven times heavier, at 5,135.9 Da against 711.85 Da.

Has Tesamorelin been tested in randomised human trials?

Yes, more extensively than any other peptide in this class. Two multicentre double-blind placebo-controlled phase 3 trials randomised 412 and 404 patients respectively, with a pooled analysis of 806 patients and 52-week extension data. Additional randomised trials examined liver fat in 50 and 61 participants, cognition in 152 older adults, and glycaemic safety in 53 patients with type 2 diabetes.

What did the pivotal Tesamorelin trial find?

In the 2007 New England Journal of Medicine trial of 412 antiretroviral-treated patients, visceral adipose tissue decreased by 15.2% in the Tesamorelin group and increased by 5.0% in the placebo group over 26 weeks. Triglycerides decreased by 50 mg/dL versus a 9 mg/dL increase on placebo, IGF-1 increased 81.0% versus a 5.0% decline, and no significant glycaemic differences were seen between groups.

Is Tesamorelin approved in Canada?

Health Canada issued a Notice of Compliance for Egrifta to Theratechnologies Inc. on 29 April 2014, for excess visceral adipose tissue in treatment-experienced adult HIV-infected patients with lipodystrophy. Health Canada's Summary Basis of Decision records both Canadian DINs, 02423677 and 02438712, as discontinued, so there is no marketed Canadian product. Tesamorelin has no Health Canada authorisation for any other purpose.

Why was Tesamorelin not approved in Europe?

The application was withdrawn rather than refused. On 26 June 2012 Ferrer Internacional withdrew its marketing authorisation application for Egrifta while it was under review by the Committee for Medicinal Products for Human Use. The company stated that the CHMP considered that the provided data did not allow it to conclude on a positive benefit-risk balance.

What is Tesamorelin's half-life?

Very short. The Egrifta SV prescribing information reports a mean elimination half-life of 8 minutes in healthy subjects and the Egrifta WR labelling reports 11 minutes. Absolute subcutaneous bioavailability is less than 4%, median time to peak concentration is 0.15 hours, and mean volume of distribution is 4.8 plus or minus 1.9 L/kg. In dogs, apparent elimination half-life for immunoreactive TH9507 ranged from 21 to 45 minutes.

Is Tesamorelin banned in sport?

Yes. Tesamorelin is named on the World Anti-Doping Agency Prohibited List in section S2, Peptide Hormones, Growth Factors, Related Substances and Mimetics, under the entry for growth hormone-releasing hormone and its analogues, alongside CJC-1293, CJC-1295 and sermorelin. Section S2 substances are prohibited at all times, both in and out of competition.

Does ThePeptide.ca sell Tesamorelin?

Yes. Tesamorelin 10mg is in stock at $99.99 CAD and is supplied strictly as a laboratory research material. The current lot, CS-te10-0616, was independently assayed by Janoshik Analytical, the manufacturer's third-party laboratory, at 99.174% purity by HPLC with 11.56 mg of measured peptide content per vial, published under Janoshik ref 198440 and readable on that laboratory's own verification system. That is a manufacturer result rather than a certificate issued to us: the lot is with Testides in Toronto for our own confirmatory testing and is shown as pending until that certificate is released. Tesamorelin is not approved by Health Canada or the FDA and is not for human or veterinary use.

Sources

  1. Ferdinandi ES, Brazeau P, High K, Procter B, Fennell S, Dubreuil P. Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Basic & Clinical Pharmacology & Toxicology. 2007;100(1):49–58. PMID 17214611.
  2. Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. New England Journal of Medicine. 2007;357(23):2359–70. PMID 18057338.
  3. Falutz J, Potvin D, Mamputu JC, et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. Journal of Acquired Immune Deficiency Syndromes. 2010;53(3):311–22. PMID 20101189. Registered as NCT00435136 and NCT00608023.
  4. Falutz J, Mamputu JC, Potvin D, et al. Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data. Journal of Clinical Endocrinology & Metabolism. 2010;95(9):4291–4304. PMID 20554713.
  5. Stanley TL, Feldpausch MN, Oh J, et al. Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. JAMA. 2014;312(4):380–389. PMID 25038357.
  6. Stanley TL, Fourman LT, Feldpausch MN, et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Lancet HIV. 2019;6(12):e821–e830. PMID 31611038. NCT02196831.
  7. Baker LD, Barsness SM, Borson S, et al. Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults. Archives of Neurology. 2012;69(11):1420–1429. PMID 22869065.
  8. Friedman SD, Baker LD, Borson S, et al. Growth hormone-releasing hormone effects on brain gamma-aminobutyric acid levels in mild cognitive impairment and healthy aging. JAMA Neurology. 2013;70(7):883–890. PMID 23689947.
  9. Clemmons DR, Miller S, Mamputu JC. Safety and metabolic effects of tesamorelin, a growth hormone-releasing factor analogue, in patients with type 2 diabetes: a randomized, placebo-controlled trial. PLOS ONE. 2017;12(6):e0179538. doi:10.1371/journal.pone.0179538; PMCID PMC5472315. Registered as NCT01264497.
  10. U.S. Food and Drug Administration / DailyMed. EGRIFTA SV (tesamorelin) for injection — prescribing information. dailymed.nlm.nih.gov.
  11. U.S. Food and Drug Administration / DailyMed. EGRIFTA WR (tesamorelin) for injection — prescribing information. dailymed.nlm.nih.gov.
  12. Health Canada. Summary Basis of Decision for Egrifta (tesamorelin acetate), Theratechnologies Inc. Notice of Compliance 29 April 2014, NDS #131836. dhpp.hpfb-dgpsa.ca.
  13. European Medicines Agency. Ferrer Internacional S.A. withdraws its marketing authorisation application for Egrifta (tesamorelin). 26 June 2012. ema.europa.eu.
  14. CADTH. Clinical Review Report: Tesamorelin (Egrifta). NCBI Bookshelf NBK539127. ncbi.nlm.nih.gov.
  15. LiverTox: Clinical and Research Information on Drug-Induced Liver Injury. Tesamorelin. NCBI Bookshelf NBK548730. ncbi.nlm.nih.gov.
  16. UniProt Consortium. P01286 · SLIB_HUMAN, Somatoliberin (GHRH). uniprot.org.
  17. World Anti-Doping Agency. Prohibited List, section S2: Peptide Hormones, Growth Factors, Related Substances and Mimetics. wada-ama.org.
  18. Health Canada. Think twice before injecting peptides bought online: unauthorized products can seriously harm you. Public advisory, 9 April 2026. recalls-rappels.canada.ca.

Changelog. 4 September 2026 — First published. Written from the 2007 non-clinical characterisation of TH9507 (the trans-3-hexenoyl modification and dipeptidyl aminopeptidase-IV resistance), the two pivotal phase 3 trials and their pooled analysis, the 2014 and 2019 liver-fat trials, the 2012 cognition trial and the 2017 type 2 diabetes safety trial, plus the FDA prescribing information, Health Canada’s Summary Basis of Decision and the EMA withdrawal notice. Structural and sequence data cross-checked against UniProt P01286 and the approved labelling. Trial dose levels are intentionally not reproduced. 13 September 2026 — Availability updated: Tesamorelin 10mg is now stocked, lot CS-te10-0616, independently assayed by Janoshik Analytical at 99.174% by HPLC (ref #198440). That is the manufacturer’s result; our own confirmatory testing at Testides is pending and the lot is marked pending on the lab results page until it is released.

Final disclaimer This content is educational information summarising published research and regulatory records, and is not medical, legal or professional advice. Regulatory status is summarised as of the last-updated date and can change — verify against the linked primary sources. Tesamorelin 10mg, like every other product sold by ThePeptide.ca, is supplied strictly for laboratory and in-vitro research use, is not approved by Health Canada or the FDA, and is not for human or veterinary consumption. If you are considering compounds of this kind for personal health reasons, read the Health Canada advisory linked above and speak to a licensed healthcare practitioner.
Back to blog